PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N02067.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 116aa    MW: 13479.2 Da    PI: 9.2675
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N02067.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB76.34.4e-241681684
             NF-YB 16 imkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
                      +mkk++P+ aki ++ k    + vsefi fvt+easd+c+re+rkt+n  d++wal+ l f++y +++ 
  Migut.N02067.1.p  1 MMKKIMPQSAKIQEKQKRE-SKFVSEFICFVTGEASDRCNRENRKTVNKYDICWALSLLRFDNYSDAML 68
                      69**********9998876.579******************************************9984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008084.0E-10155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.77E-16194IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.4E-20189IPR009072Histone-fold
PRINTSPR006156.9E-51937No hitNo description
PRINTSPR006156.9E-53856No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MMKKIMPQSA KIQEKQKRES KFVSEFICFV TGEASDRCNR ENRKTVNKYD ICWALSLLRF  60
DNYSDAMLRV NKSKNKTNNN CSSEEKDDER NFRDSTTPFD FGILETGRKS LANPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-141671784NF-YB
4awl_B3e-141671885NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-141671885NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012850788.12e-34PREDICTED: nuclear transcription factor Y subunit B-4-like
TrEMBLA0A022RQ781e-43A0A022RQ78_ERYGU; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.11e-21nuclear factor Y, subunit B4